PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.07G249000.1.p
Common NameGLYMA_07G249000, LOC100786046
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 122aa    MW: 13738.5 Da    PI: 6.6304
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.07G249000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB171.59.5e-5418113297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdr+lPianv+rimk++lP nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal++lGf+dy+epl+ yl++yr
  Glyma.07G249000.1.p  18 REQDRLLPIANVGRIMKQILPPNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGSLGFDDYAEPLRRYLQRYR 107
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          ele ++
  Glyma.07G249000.1.p 108 ELEVDR 113
                          ***987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-5111115IPR009072Histone-fold
SuperFamilySSF471131.71E-3820117IPR009072Histone-fold
PfamPF008082.3E-272387IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-195169No hitNo description
PROSITE patternPS0068505470IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-197088No hitNo description
PRINTSPR006151.8E-1989107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MVDNVGGSSS NAENSGIREQ DRLLPIANVG RIMKQILPPN AKISKESKET MQECVSEFIS  60
FVTSEASEKC RKERRKTVNG DDICWALGSL GFDDYAEPLR RYLQRYRELE VDRGNSPPKR  120
E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-4517108192Transcription factor HapC (Eurofung)
4g92_B2e-4517108192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003529577.11e-85PREDICTED: nuclear transcription factor Y subunit B-5-like
SwissprotO822481e-55NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLK7L3Q02e-85K7L3Q0_SOYBN; Uncharacterized protein
STRINGGLYMA07G37840.25e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.12e-49nuclear factor Y, subunit B5